GLP 2 30mg

£329.00

& Free Shipping

This premium-grade Glucagon-Like Peptide-2 (GLP-2) 30mg vial is manufactured specifically for laboratory research and analytical studies within the United Kingdom. Formulated as a highly stable, sterile-filtered, and lyophilized (freeze-dried) white powder, it offers exceptional structural integrity for cell culture and animal model testing. With a verified purity of over 99% via HPLC analysis, our GLP-2 peptide represents the gold standard for research into gastrointestinal lining regeneration, nutrient absorption mechanics, and epithelial cell biology.

- +
Guaranteed Safe Checkout

Buy GLP 2 30mg UK | High-Purity Glucagon-Like Peptide-2 for Research

Glucagon-Like Peptide-2 (GLP-2) is a potent, 33-amino acid peptide hormone co-secreted with GLP-1 by intestinal enteroendocrine L-cells following nutrient ingestion. While GLP-1 is widely researched for its metabolic and glycemic control applications, GLP-2 is the premier subject for studies focusing on intestinal growth, tissue repair, and mucosal barrier preservation.

Our GLP-2 30mg product provides researchers with a concentrated, highly stable format to investigate the hormone’s physiological mechanisms. Because endogenous GLP-2 typically exhibits a very short half-life of approximately 7 minutes in vivo due to rapid enzymatic degradation, high-concentration laboratory samples are crucial for establishing reliable in vitro and in vivo models. This 30mg vial contains no additives or excipients, ensuring that your experimental outcomes remain unpolluted by external chemical interference.

Benefits of GLP-2 in Scientific Research

Studies involving GLP-2 highlight its unique multi-functional role across mammalian gastrointestinal and nervous systems. When utilized in approved laboratory models, GLP-2 demonstrates a broad spectrum of research benefits:

  • Intestinal Epithelial Proliferation: Promotes the growth of the mucosal lining by stimulating crypt cell division and reducing cellular apoptosis (programmed cell death).

  • Enhancing Barrier Integrity: Investigated for its ability to reduce tight-junction permeability, effectively preventing pathogens from crossing the gut-vascular barrier.

  • Nutrient Transport Acceleration: Upregulates active hexose and lipid transport mechanisms, aiding the study of nutrient-malabsorption syndromes like Short Bowel Syndrome (SBS).

  • Anti-Inflammatory Properties: Helps downregulate mucosal inflammatory cytokines, making it a critical research subject for inflammatory bowel diseases (IBD) like Crohn’s and colitis.

  • Vasoactive and Motility Effects: Enhances mesenteric blood flow while simultaneously reducing gastric acid secretion and gastrointestinal transit speed to optimize nutrient contact time.

Guaranteed High Purity

Quality is the foundation of reproducible science. Every batch of our GLP-2 30mg undergoes rigorous High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (MS) testing. We guarantee a minimum purity of 99.0%, with total impurities kept under 1.0%. This high degree of purification ensures that researchers observe genuine peptide interactions without confounding variables caused by synthesis side-products or residual trifluoroacetate (TFA) salts.

Usage & Reconstitution Info

Proper reconstitution preserves the fragile tertiary structure of the 33-amino acid chain.

  1. Preparation: Allow the vial to reach room temperature before reconstitution to prevent micro-condensation.

  2. Solvent Selection: Reconstitute using sterile, bacteriostatic water or sterile saline. For long-term analytical storage, a carrier protein like 0.1% Bovine Serum Albumin (BSA) can be added to prevent glass vial adsorption.

  3. Dilution: Gently stream the diluent down the inner glass wall of the vial. Do not shake. Swirl the vial with a slow, circular motion until the white lyophilized cake is fully dissolved.

  4. Aliquoting: To minimize repeated freeze-thaw cycles, partition the reconstituted solution into single-use plastic microtubes immediately.

Storage Guidelines

Peptide State Recommended Temperature Maximum Shelf Life
Lyophilized (Dry Cake) -20°C to -80°C Up to 24 Months
Lyophilized (Short Term) 2°C to 8°C (Refrigerated) Up to 3 Months
Reconstituted Solution 2°C to 8°C (Refrigerated) 7 to 14 Days

Keep all vials stored in a desiccated environment away from direct light exposure to prevent oxidative degradation and moisture hydrolysis.

Quality Assurance & Lab Testing

Each purchase of our GLP-2 30mg peptide is accompanied by a batch-specific Certificate of Analysis (CoA). This documentation details the precise HPLC chromatogram trace, demonstrating purity, and the Mass Spectrometry report, verifying the exact molecular mass of 3766.16 Da. We update our lab analyses with every production run to ensure absolute consistency.

Secure UK Shipping & Delivery

All domestic orders are processed and shipped from our secure UK warehouse. To maintain structural stability during transport, vials are packed in temperature-insulated, shock-resistant packaging.

  • Next-Day UK Delivery: Fully tracked shipping option available for all UK mainland addresses.

  • Discrete Packaging: Vials are shipped in secure, neutral outer packaging to protect transit privacy.

  • Cold-Chain Shipping: Available upon request to maintain temperature control during transit.

Frequently Asked Questions (FAQs)

What is the molecular sequence of GLP-2?

The human GLP-2 sequence consists of 33 amino acids:

HADGSFSDEMNTILDNLAARDFINWLIQTKITD.

Can this product be used for human consumption?

No. This GLP-2 30mg product is sold strictly for in vitro laboratory research and animal testing studies. It is not a licensed medicine, food additive, or cosmetic product in the UK, and must not be administered to humans under any circumstances.

What is the difference between GLP-1 and GLP-2?

Although both are derived from the same proglucagon gene, GLP-1 mainly targets pancreatic beta-cells to stimulate insulin release. GLP-2 specifically targets receptors in the gut tissue and central nervous system to promote tissue regeneration and nutrient absorption.

How do I verify the purity of my batch?

Every shipment includes a downloadable PDF link to your batch’s specific HPLC and MS analysis report, verifying its molecular weight and >99.0% purity profile.

Reviews

There are no reviews yet.

Be the first to review “GLP 2 30mg”

Your email address will not be published. Required fields are marked *

Shopping Cart
GLP 2 30mgGLP 2 30mg
£329.00
- +
Scroll to Top